PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008115m
Common NameEUTSA_v10008115mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family G2-like
Protein Properties Length: 343aa    MW: 38339.9 Da    PI: 8.11
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008115mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32210265156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rF++a++qLGGs++AtPk+i++lmkv+gLt+++vkSHLQkYRl+
  Thhalv10008115m 210 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDLMKVNGLTNDEVKSHLQKYRLH 265
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.509207267IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-28208268IPR009057Homeodomain-like
SuperFamilySSF466897.89E-18208268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26210265IPR006447Myb domain, plants
PfamPF002492.4E-7212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MIKIGFTEDY TLKMKRCHDY VEALEQEQKK IQVFQRELPL CLELVTQEIQ SCRKELSEFS  60
TTSEQVHGQS ECSERTTSES GDGAAVFEEF MPIKLNSSSS NEHESTCEPN KDDGAENNGD  120
KKKSDWLRSV QLWNQPKEDQ TTTVVVDGKR NGGAFQPFHK EKPVVAAAAK ADSQPVKAIT  180
PTPTTSSSTA ETVGSKREPE NHKHSQMHRK QRRCWSPELH RRFLHALQQL GGSHVATPKQ  240
IRDLMKVNGL TNDEVKSHLQ KYRLHTRRPA TPAMTNGGEN PQQPQFMVVE GIWVPSHDAA  300
NRVYAPVAVQ PPLASPSEDR SSRRCKSPTT SSTHTAHLLP LS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415885.10.0hypothetical protein EUTSA_v10008115mg
TrEMBLV4L3B60.0V4L3B6_EUTSA; Uncharacterized protein
STRINGAT1G25550.11e-150(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-146G2-like family protein